30-MINUTE MEALS! Get the email series now
Royal Recipe

Air Fryer Bang Bang Cauliflower

5 from 1 vote
1 Comments
Lena Moreau
By: Lena MoreauUpdated: Dec 26, 2025
This post may contain affiliate links. Please read our disclosure policy.

Crispy air-fried cauliflower tossed in a creamy, sweet-spicy bang bang sauce. A crowd-pleasing appetizer or vegetarian main that's quick, crunchy, and addictive.

Air Fryer Bang Bang Cauliflower

This Air Fryer Bang Bang Cauliflower is one of those recipes that arrived as a happy accident and then became a household commandment. I first tested this combination on a weeknight when the kids wanted something crunchy and I wanted to skip the deep fryer. The result was a golden, crunchy exterior with tender cauliflower inside, all coated in a sweet-spicy, creamy sauce that had everyone dipping and double-dipping. It quickly displaced other snacks as our go-to for game nights, quick dinners, and impromptu gatherings. The flavors have that satisfying contrast of heat and sweetness balanced by the cooling mouthfeel of mayonnaise, and the texture is what makes it memorable: crunchy seeds of panko give every bite a toasted note, while the cauliflower stays just tender enough to give a bite without going mushy.

I discovered this specific sauce blend while experimenting with pantry staples: sweet chili sauce plus mayo, a touch of honey to round out the acidity, and a splash of hot sauce for lift. Air frying transforms ordinary florets into something indulgent without the oil bath, and because the breading is simple, it is easy to keep a gluten-free or vegan version on hand. This dish is special because it proves that vegetable-forward food can be playful, shareable, and utterly craveable — and it comes together fast. Serve it as an appetizer to impress guests or plate it as a fun vegetarian main with steamed rice and a crunchy salad on the side.

Why You'll Love This Recipe

  • Ready in about 30 minutes from start to finish, perfect for busy weeknights and last-minute entertaining.
  • Uses pantry staples: mayonnaise, sweet chili sauce, panko, and a single head of cauliflower.
  • Air frying produces a deep-fried crunch using very little oil, making it lighter but still indulgent.
  • Highly adaptable: swap in gluten-free flour and breadcrumbs or vegan mayo and egg substitutes to fit diets.
  • Crowd-pleaser for all ages; great for parties because it is easy to make in batches and stays crispy when tossed at the last minute.
  • Texture-driven: the contrast of crunchy panko and creamy sauce makes every bite interesting and satisfying.

My family’s reaction the first time I brought this to the table was pure delight. My sister suggested adding sesame seeds, my son declared it better than takeout, and I learned that pressing the breadcrumbs firmly gives the best crisp. This recipe has been on rotation ever since, and I always get requests for the sauce measurements so guests can make it at home.

Ingredients

  • Cauliflower: 1 medium head cauliflower, trimmed and cut into bite-sized florets. Choose a firm, white head without brown spots; fresher heads have a sweeter, nuttier flavor and stand up better to air frying.
  • All-Purpose Flour: 1/2 cup all-purpose flour to help the egg and breadcrumbs adhere. For a gluten-free option, use a 1-to-1 gluten-free baking flour.
  • Eggs: 2 large eggs, beaten. Eggs provide binding and help the panko crisp. For a vegan option, use a flax or aquafaba dip (3 tablespoons aquafaba or 1.5 tablespoons flax meal mixed with 4.5 tablespoons water to replace 2 eggs).
  • Panko Breadcrumbs: 1 cup panko breadcrumbs for extra crunch. Japanese-style panko gives the best texture; swap for gluten-free breadcrumbs if needed.
  • Seasoning: Salt and freshly ground black pepper to taste. I like a half teaspoon of fine salt and a quarter teaspoon of pepper for a medium head of cauliflower.
  • Bang Bang Sauce: 1/2 cup mayonnaise, 1/4 cup sweet chili sauce, 1 tablespoon honey, and 1 to 2 teaspoons hot sauce depending on your heat tolerance. Use vegan mayo and maple syrup for a vegan version. Sweet chili sauce brings sweet-tangy notes that pair perfectly with the mayo base.

Instructions

Preheat and Prep: Preheat the air fryer to 400 degrees F. If your unit requires preheating, set it for 3 to 5 minutes. While the air fryer heats, wash and cut the cauliflower into even, bite-sized florets so they cook uniformly. Dry the florets thoroughly on a clean kitchen towel to help the coating adhere. Season and Dredge: In a large bowl, toss the florets with a light sprinkle of salt and pepper. Place the flour in one shallow bowl, the beaten eggs in another, and the panko in a third. Working one floret at a time, dredge in flour, then dip into the egg, and press into the panko so the crumbs adhere. Press firmly to compact the panko; this creates a stronger crust that stays attached during cooking. Arrange in the Air Fryer: Place breaded florets in a single layer in the air fryer basket, leaving space between pieces. Cook in batches if necessary; overcrowding causes steaming rather than crisping. Spray the florets lightly with cooking spray if you like a deeper golden color. Air Fry: Air fry at 400 degrees F for 12 to 15 minutes, shaking or flipping halfway through. Look for an even golden-brown crust and a tender interior when tested with a fork. Exact time depends on your air fryer model and floret size; start checking at 10 minutes to avoid overbrowning. Prepare the Sauce: While the cauliflower cooks, whisk together 1/2 cup mayonnaise, 1/4 cup sweet chili sauce, 1 tablespoon honey, and 1 to 2 teaspoons hot sauce in a medium bowl. Adjust the hot sauce to taste and add a pinch of salt if needed. If you prefer a thinner sauce for drizzling, add 1 to 2 teaspoons of water or rice vinegar. Toss and Serve: When the florets are crisp, transfer them to a large bowl and toss gently but quickly with the bang bang sauce until coated. Serve immediately so the crust stays crisp. Garnish with sliced green onions and sesame seeds if desired. Air fryer bang bang cauliflower on a serving plate

You Must Know

  • This holds best when served immediately; toss with sauce right before serving to retain crunch.
  • Leftover cauliflower keeps in the refrigerator for 2 to 3 days but will lose crispness; reheat in the air fryer for 3 to 5 minutes to revive texture.
  • High in fiber and vitamins from cauliflower, though the panko and sauce add calories; estimate about 300 to 350 calories per serving depending on portions.
  • Gluten-free and vegan versions are easy by swapping flour, breadcrumbs, and mayonnaise; however, texture will vary slightly.

My favorite aspect is how forgiving the process is: mistakes in breading can be fixed by pressing another layer of panko, and the sauce can be adjusted to personal heat preferences. At a backyard gathering, I served this alongside grilled skewers and watched everyone reach for seconds. The instant feedback loop between crunch and creamy sauce keeps guests engaged and delighted.

Close up of crispy panko cauliflower with bang bang sauce

Storage Tips

Store leftover florets in an airtight container in the refrigerator for up to 3 days. Keep the sauce separate in a small jar to preserve the crispness. To re-crisp, arrange on the air fryer tray or a baking sheet and reheat at 350 degrees F for 3 to 5 minutes, checking frequently. Avoid microwaving as that will make the crust soggy. For freezing, freeze the plain, cooked florets on a baking sheet until firm, then transfer to a freezer bag for up to 2 months. Reheat from frozen in the air fryer at 375 degrees F for 8 to 10 minutes.

Ingredient Substitutions

For a gluten-free version, swap the all-purpose flour for a cup-for-cup gluten-free flour blend and use gluten-free panko. To make it vegan, replace eggs with aquafaba or a flax egg and use vegan mayonnaise and agave syrup instead of honey. For a lighter coating, use crushed cornflakes or almond meal in place of panko; almond meal will yield a nuttier flavor and darker color. If you prefer more tang, add a teaspoon of rice vinegar to the sauce. Adjust heat by changing the hot sauce to sriracha for a garlicky kick.

Bang bang sauce in a bowl next to air fried cauliflower

Serving Suggestions

Serve as an appetizer with toothpicks and extra bang bang sauce on the side, or turn it into a main by plating over steamed jasmine rice and a crunchy cabbage slaw. Garnish with sliced scallions, sesame seeds, or cilantro leaves for freshness. Pair with light beers or crisp white wine for a balanced meal. For a party, place the warm florets in a shallow bowl and offer a trio of sauces: extra bang bang, spicy mayo, and a tangy soy dipping sauce.

Cultural Background

Bang bang-style sauces originated as playful, sweet-spicy condiments in Asian-American kitchens, taking inspiration from Chinese sweet chili and Western creamy dressings. The name evokes a lively, attention-grabbing flavor profile rather than a specific regional origin. This version combines familiar Thai sweet chili with a creamy mayo base, creating a cross-cultural fusion that appeals to many palates. It demonstrates how simple pantry items can be reinterpreted into bold, modern comfort food.

Seasonal Adaptations

In spring and summer, serve the florets with a light cucumber salad and fresh herbs. In colder months, swap honey for maple syrup and add a pinch of smoked paprika to the panko for warmth. For holiday hosting, add roasted chestnut crumbs or pepitas to the coating for a festive crunch. The recipe scales well, so you can increase batches for outdoor gatherings or taper ingredients for a cozy two-person meal.

Meal Prep Tips

Prep the florets and set up a breading station the day before to save time. Keep the flour, egg substitute, and panko in separate covered bowls in the fridge and assemble just before cooking to avoid sogginess. Make the sauce up to three days ahead; flavors deepen in the refrigerator. For batch cooking, air fry multiple trays and keep cooked florets warm in a 200 degree F oven while you finish remaining batches. Toss with sauce only when ready to serve.

This Air Fryer Bang Bang Cauliflower is an invitation to make veggies exciting. The combination of technique and simple ingredients yields a dish that keeps people returning to the table. Try the variations, experiment with heat levels, and make it your family’s next favorite snack or centerpiece.

Pro Tips

  • Press the panko firmly onto each floret to help the coating stay attached during air frying.

  • Dry florets completely before breading to improve adhesion and crisping.

  • Toss with sauce just before serving to keep the crust crunchy.

  • Re-crisp leftovers in the air fryer for a few minutes instead of microwaving.

This nourishing air fryer bang bang cauliflower recipe is sure to be a staple in your kitchen. Enjoy every moist, high protein slice — it is perfect for breakfast or as a wholesome snack any time.

Tags

Appetizers & Snacksair fryercauliflowerrecipevegetariansnackgame-nightquick-dinnergluten-free optionbang-bang-sauce
No ratings yet

Air Fryer Bang Bang Cauliflower

This Air Fryer Bang Bang Cauliflower recipe makes perfectly juicy, tender, and flavorful steak every time! Serve with potatoes and a side salad for an unforgettable dinner in under 30 minutes.

Servings: 4 steaks
Air Fryer Bang Bang Cauliflower
Prep:15 minutes
Cook:15 minutes
Rest Time:10 mins
Total:30 minutes

Ingredients

Cauliflower Ingredients

Bang Bang Sauce Ingredients

Instructions

1

Preheat and Prep

Preheat the air fryer to 400 degrees F. Trim and cut cauliflower into even florets and dry them thoroughly to help coating adhere.

2

Season and Dredge

Season florets lightly with salt and pepper. Set up three bowls: flour, beaten eggs, and panko. Dredge each floret in flour, dip in egg, and press into panko so crumbs stick.

3

Arrange in the Air Fryer

Place breaded florets in a single layer in the air fryer basket without crowding. Spray lightly with oil if desired for deeper color.

4

Air Fry

Cook at 400 degrees F for 12 to 15 minutes, shaking or flipping halfway. Look for even golden color and tender interior when tested with a fork.

5

Prepare the Sauce

Whisk together mayonnaise, sweet chili sauce, honey, and hot sauce. Adjust heat and sweetness to taste, and thin with a teaspoon of water or rice vinegar if needed.

6

Toss and Serve

Transfer hot florets to a large bowl and toss gently with the sauce until coated. Serve immediately with optional green onions and sesame seeds.

Last Step: Please leave a rating and comment letting us know how you liked this recipe! This helps our business to thrive and continue providing free, high-quality recipes for you.

Nutrition

Calories: 320kcal | Carbohydrates: 28g | Protein:
8g | Fat: 18g | Saturated Fat: 5g |
Polyunsaturated Fat: 4g | Monounsaturated Fat:
7g | Trans Fat: 1g | Cholesterol: 253mg | Sodium:
0mg | Potassium: 953mg | Fiber: 0g | Sugar:
0g | Vitamin A: 577IU | Vitamin C: 3mg | Calcium:
47mg | Iron: 6mg

Did You Make This?

Leave a comment & rating below or tag
@feedcooks on social media!

Air Fryer Bang Bang Cauliflower

Categories:

Air Fryer Bang Bang Cauliflower

Did You Make This?

Leave a comment & rating below or tag @feedcooks on social media!

Rate This Recipe

Share This Recipe

Enjoyed this recipe? Share it with friends and family, and don't forget to leave a review!

Comments (1)

Leave a Comment

0/1000 characters
Food Lover
1 day ago

This recipe looks amazing! Can't wait to try it.

Rating:

Comments are stored locally in your browser. Server comments are displayed alongside your local comments.

Family Photo

Hi, I'm Lena!

Chef and recipe creator specializing in delicious Appetizers & Snacks cooking. Passionate about sharing easy-to-follow recipes that bring families together around the dinner table.

Get My 30-Minute Meals email series!

Quick and easy dinner ideas delivered to your inbox.